DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp-12.2

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_498776.1 Gene:hsp-12.2 / 176148 WormBaseID:WBGene00002011 Length:110 Species:Caenorhabditis elegans


Alignment Length:77 Identity:23/77 - (29%)
Similarity:46/77 - (59%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVT 123
            |:.:::.|||:.::  |::|||..:. :|:..:.|.: ::..|..:|...|.:.||:..:...|.
 Worm    31 KEKFEVGLDVQFFTPKEIEVKVSGQE-LLIHCRHETR-SDNHGTVAREINRAYKLPDDVDVSTVK 93

  Fly   124 STLSSDGVLTIS 135
            |.|::.|||||:
 Worm    94 SHLATRGVLTIT 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 23/77 (30%)
hsp-12.2NP_498776.1 metazoan_ACD 26..108 CDD:107247 23/77 (30%)

Return to query results.
Submit another query.