DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp-12.2

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_498776.1 Gene:hsp-12.2 / 176148 WormBaseID:WBGene00002011 Length:110 Species:Caenorhabditis elegans


Alignment Length:77 Identity:23/77 - (29%)
Similarity:46/77 - (59%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVT 123
            |:.:::.|||:.::  |::|||..:. :|:..:.|.: ::..|..:|...|.:.||:..:...|.
 Worm    31 KEKFEVGLDVQFFTPKEIEVKVSGQE-LLIHCRHETR-SDNHGTVAREINRAYKLPDDVDVSTVK 93

  Fly   124 STLSSDGVLTIS 135
            |.|::.|||||:
 Worm    94 SHLATRGVLTIT 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 23/77 (30%)
metazoan_ACD 61..138 CDD:107247 23/77 (30%)
hsp-12.2NP_498776.1 metazoan_ACD 26..108 CDD:107247 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.