DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hspb1

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 MGIID:96240 Length:209 Species:Mus musculus

Alignment Length:206 Identity:57/207 (28%)
Similarity:85/207 (41%) Gaps:60/207 (29%)


  Fly     5 PMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARW---------------QEQEFA 54
            |...|:.::...:|||          |..||     .|...|.|               .....|
Mouse    24 PAHSRLFDQAFGVPRL----------PDEWS-----QWFSAAGWPGYVRPLPAATAEGPAAVTLA 73

  Fly    55 PPA---TVNK-------------DGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGG 101
            .||   .:|:             |.::::|||..::  ||.||. .|.||.:.||.|:::.|. |
Mouse    74 APAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKT-KEGVVEITGKHEERQDEH-G 136

  Fly   102 YSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTI-------EQTGEP 159
            |.||.|.|::.||.|.:...|:|:||.:|.||:..|.|..|.::   .|:||       .|.|.|
Mouse   137 YISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQS---AEITIPVTFEARAQIGGP 198

  Fly   160 AKKSAEEPNDK 170
            ....:|:...|
Mouse   199 EAGKSEQSGAK 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 50/177 (28%)
metazoan_ACD 61..138 CDD:107247 32/92 (35%)
Hspb1NP_038588.2 Interaction with TGFB1I1. {ECO:0000250} 74..209 44/140 (31%)
ACD_HspB1_like 88..173 CDD:107230 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.