DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and CRYAA

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_000385.1 Gene:CRYAA HGNCID:2388 Length:173 Species:Homo sapiens

Alignment Length:147 Identity:44/148 (30%)
Similarity:70/148 (47%) Gaps:13/148 (9%)


  Fly    24 FHAFFHE--------PPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKV 78
            |..||.|        |.:.|...|...|.:.|............::|.:.:.||||.:|  :|.|
Human    23 FDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTV 87

  Fly    79 KVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGV 142
            ||.|: .|.:.||..::: :..||.||.|.||:.||...:...::.:||:||:||...|. ..|:
Human    88 KVQDD-FVEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGL 150

  Fly   143 QETLKEREVTIEQTGEP 159
            ..|..||.:.:.:..:|
Human   151 DATHAERAIPVSREEKP 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 43/141 (30%)
metazoan_ACD 61..138 CDD:107247 30/79 (38%)
CRYAANP_000385.1 Crystallin 1..50 CDD:306911 7/27 (26%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 30/87 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65242662
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.