DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Cryab

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:163 Identity:56/163 - (34%)
Similarity:86/163 - (52%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PFHA-------FF--H--EPPVWSVAL--------PRNWQQIARWQEQEFAPPATVNKDGYKLTL 68
            |||:       ||  |  |..::|.|.        |.::.:...|.:...: ...:.||.:.:.|
Mouse    16 PFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLS-EMRLEKDRFSVNL 79

  Fly    69 DVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGV 131
            |||.:|  |||||||.: |:.|.||.|:::.|. |:.||.|.|::.:|...:...:||:||||||
Mouse    80 DVKHFSPEELKVKVLGD-VIEVHGKHEERQDEH-GFISREFHRKYRIPADVDPLTITSSLSSDGV 142

  Fly   132 LTISVPNPPGVQETLKEREVTIEQTGEPAKKSA 164
            ||:   |.|..|.:..||.:.|.:..:||..:|
Mouse   143 LTV---NGPRKQVSGPERTIPITREEKPAVAAA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 52/151 (34%)
metazoan_ACD 61..138 CDD:107247 36/78 (46%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419 9/35 (26%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 38/87 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.