DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Cryab

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab MGIID:88516 Length:175 Species:Mus musculus

Alignment Length:163 Identity:56/164 (34%)
Similarity:86/164 (52%) Gaps:27/164 (16%)


  Fly    23 PFHA-------FF--H--EPPVWSVAL--------PRNWQQIARWQEQEFAPPATVNKDGYKLTL 68
            |||:       ||  |  |..::|.|.        |.::.:...|.:...: ...:.||.:.:.|
Mouse    16 PFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLS-EMRLEKDRFSVNL 79

  Fly    69 DVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGV 131
            |||.:|  |||||||.: |:.|.||.|:::.|. |:.||.|.|::.:|...:...:||:||||||
Mouse    80 DVKHFSPEELKVKVLGD-VIEVHGKHEERQDEH-GFISREFHRKYRIPADVDPLTITSSLSSDGV 142

  Fly   132 LTISVPNPPGVQETLKEREVTIEQTGEPAKKSA 164
            ||:   |.|..|.:..||.:.|.:..:||..:|
Mouse   143 LTV---NGPRKQVSGPERTIPITREEKPAVAAA 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 53/152 (35%)
metazoan_ACD 61..138 CDD:107247 36/79 (46%)
CryabNP_001276711.1 Crystallin 1..51 CDD:278926 9/35 (26%)
IbpA 11..161 CDD:223149 52/151 (34%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65319901
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.