DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Cryaa

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa MGIID:88515 Length:202 Species:Mus musculus

Alignment Length:141 Identity:43/142 (30%)
Similarity:73/142 (51%) Gaps:15/142 (11%)


  Fly    25 HAFF--HEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESV 85
            |.:|  |:|...:   |:|....|.:..:     ...::|.:.:.||||.:|  :|.|||| |..
Mouse    67 HMWFVMHQPHAGN---PKNNPVKASYMAK-----VRSDRDKFVIFLDVKHFSPEDLTVKVL-EDF 122

  Fly    86 VLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQETLKER 149
            |.:.||..::: :..||.||.|.||:.||...:...::.:||:||:||.|.|. ..|:.....||
Mouse   123 VEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSER 186

  Fly   150 EVTIEQTGEPA 160
            .:.:.:..:|:
Mouse   187 AIPVSREEKPS 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 42/134 (31%)
metazoan_ACD 61..138 CDD:107247 32/79 (41%)
CryaaNP_001265498.1 Crystallin 1..50 CDD:278926
alpha-crystallin-Hsps_p23-like 90..174 CDD:294116 32/91 (35%)
IbpA <93..174 CDD:223149 32/83 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65240878
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.