DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Cryaa

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:141 Identity:43/141 - (30%)
Similarity:73/141 - (51%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HAFF--HEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESV 85
            |.:|  |:|...:   |:|....|.:..:     ...::|.:.:.||||.:|  :|.|||| |..
Mouse    67 HMWFVMHQPHAGN---PKNNPVKASYMAK-----VRSDRDKFVIFLDVKHFSPEDLTVKVL-EDF 122

  Fly    86 VLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQETLKER 149
            |.:.||..::: :..||.||.|.||:.||...:...::.:||:||:||.|.|. ..|:.....||
Mouse   123 VEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSER 186

  Fly   150 EVTIEQTGEPA 160
            .:.:.:..:|:
Mouse   187 AIPVSREEKPS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 31/78 (40%)
CryaaNP_001265498.1 Crystallin 1..54 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 90..174 CDD:469641 31/90 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.