DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSPB6

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_653218.1 Gene:HSPB6 HGNCID:26511 Length:160 Species:Homo sapiens

Alignment Length:137 Identity:46/138 (33%)
Similarity:66/138 (48%) Gaps:28/138 (20%)


  Fly    11 AEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS- 74
            ||..|..|...:|:  :...|   |||||     :|:         ...:...:.:.||||.:| 
Human    40 AELAALCPTTLAPY--YLRAP---SVALP-----VAQ---------VPTDPGHFSVLLDVKHFSP 85

  Fly    75 -ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTI---- 134
             |:.|||:.|.|. |..:.|::..|. |:.:|.|.||:.||.|.:...|||.||.:|||:|    
Human    86 EEIAVKVVGEHVE-VHARHEERPDEH-GFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP 148

  Fly   135 -SVPNPP 140
             |...||
Human   149 ASAQAPP 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 43/132 (33%)
metazoan_ACD 61..138 CDD:107247 32/84 (38%)
HSPB6NP_653218.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. {ECO:0000269|PubMed:27717639} 1..72 12/51 (24%)
Crystallin 5..56 CDD:306911 5/18 (28%)
ACD_HspB4-5-6 66..144 CDD:107233 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.