DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hsp22 and HSPB6

DIOPT Version :9

Sequence 1:	NP_001027114.1	Gene:	Hsp22 / 3772576	FlyBaseID:	FBgn0001223	Length:	174	Species:	Drosophila melanogaster
Sequence 2:	NP_653218.1	Gene:	HSPB6 / 126393	HGNCID:	26511	Length:	160	Species:	Homo sapiens

Alignment Length:	137	Identity:	46/137 - (33%)
Similarity:	66/137 - (48%)	Gaps:	28/137 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 AEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS- 74
            ||..|..|...:|:  :...|   |||||     :|:         ...:...:.:.||||.:|
Human    40 AELAALCPTTLAPY--YLRAP---SVALP-----VAQ---------VPTDPGHFSVLLDVKHFSP 85

  Fly    75 -ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTI---- 134
             |:.|||:.|.|. |..:.|::..|. |:.:|.|.||:.||.|.:...|||.||.:|||:|
Human    86 EEIAVKVVGEHVE-VHARHEERPDEH-GFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP 148

  Fly   135 -SVPNPP 140
             |...||
Human   149 ASAQAPP 155

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hsp22	NP_001027114.1	IbpA	17..154	CDD:223149	43/131 (33%)
Hsp22	NP_001027114.1	metazoan_ACD	61..138	CDD:107247	32/83 (39%)
HSPB6	NP_653218.1	Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000269\|PubMed:27717639	1..72		12/50 (24%)
		Crystallin	3..58	CDD:395419	5/19 (26%)
		ACD_HspB4-5-6	66..144	CDD:107233	30/88 (34%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000383
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR45640
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	3.010