DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb2

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002932983.1 Gene:hspb2 XenbaseID:XB-GENE-940436 Length:179 Species:Xenopus tropicalis

Alignment Length:116 Identity:29/117 (25%)
Similarity:54/117 (46%) Gaps:17/117 (15%)


  Fly    24 FHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVV 86
            :|.::..|.: :....|.:.:|.|            |:..:::.|||..:  .|:.|..:|.  :
 Frog    44 YHGYYIRPRI-NKQTDRGFSEINR------------NEHKFQVFLDVCHFLPDEISVHTMDN--L 93

  Fly    87 LVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVP 137
            |.......|:.:..|:.||.|.|:::||...:...|.:.||.||:|:|..|
 Frog    94 LEVSAKHPQKIDSHGFVSRSFNRKYILPLDVDPLLVKAKLSHDGILSIEAP 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 29/117 (25%)
metazoan_ACD 61..138 CDD:107247 23/80 (29%)
hspb2XP_002932983.1 Crystallin <21..51 CDD:278926 1/7 (14%)
IbpA <63..149 CDD:223149 26/97 (27%)
alpha-crystallin-Hsps_p23-like 69..145 CDD:294116 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65404370
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.