DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb2

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002932983.1 Gene:hspb2 / 100497635 XenbaseID:XB-GENE-940436 Length:179 Species:Xenopus tropicalis


Alignment Length:116 Identity:29/116 - (25%)
Similarity:54/116 - (46%) Gaps:17/116 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVV 86
            :|.::..|.: :....|.:.:|.|            |:..:::.|||..:  .|:.|..:|.  :
 Frog    44 YHGYYIRPRI-NKQTDRGFSEINR------------NEHKFQVFLDVCHFLPDEISVHTMDN--L 93

  Fly    87 LVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVP 137
            |.......|:.:..|:.||.|.|:::||...:...|.:.||.||:|:|..|
 Frog    94 LEVSAKHPQKIDSHGFVSRSFNRKYILPLDVDPLLVKAKLSHDGILSIEAP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 23/79 (29%)
hspb2XP_002932983.1 Crystallin <21..51 CDD:425732 1/6 (17%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 69..145 CDD:469641 23/78 (29%)

Return to query results.
Submit another query.