DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb6

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis

Alignment Length:139 Identity:42/140 (30%)
Similarity:69/140 (49%) Gaps:21/140 (15%)


  Fly    17 MPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVK 79
            ||...||:  ::..|   |:..|          .:.......::||.:.:.||||.:|  ||.||
 Frog    44 MPMALSPY--YYRSP---SIPQP----------SEAGLSEVKLDKDQFSVLLDVKHFSPEELTVK 93

  Fly    80 VLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQE 144
            |:.: .|.|..|.|::..|. |:.||.|.||:.:|.......::|.||::|:|:|..|...|.::
 Frog    94 VVGD-YVEVHAKHEERPDEH-GFISREFHRRYKIPPTVSPAAISSALSAEGLLSIQAPVTAGGKQ 156

  Fly   145 TLKEREVTI 153
              :||.:.|
 Frog   157 --EERSIPI 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 42/140 (30%)
metazoan_ACD 61..138 CDD:107247 31/79 (39%)
hspb6XP_002940672.2 Crystallin 1..54 CDD:278926 4/12 (33%)
ACD_HspB4-5-6 68..149 CDD:107233 30/83 (36%)
IbpA <74..163 CDD:223149 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.