DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hsp30c

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002944274.2 Gene:hsp30c XenbaseID:XB-GENE-5764040 Length:215 Species:Xenopus tropicalis

Alignment Length:135 Identity:51/136 (38%)
Similarity:71/136 (52%) Gaps:21/136 (15%)


  Fly    47 RWQEQEFAPPATVNKDG---YKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQ-EAEQGGY--S 103
            |..|.|...|:: .|||   ::|||||:|:|  ||.||:....|: |.||.|:: ::|.|.|  .
 Frog    77 RAAETEGTSPSS-GKDGKDHFELTLDVRDFSPHELTVKMQGRRVI-VTGKHERKSDSEDGSYVHE 139

  Fly   104 SRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN---PPGVQETLKEREVTIEQTGEPAKKSAE 165
            .|.:.|...||||...::|..:||.||.|.|..|.   ||.     .||.:.|..  :||.:.|:
 Frog   140 YRQWKREAELPEGVNPEQVVCSLSKDGHLHIQAPRLALPPA-----PERPIPISM--DPAPRDAQ 197

  Fly   166 E-PND 169
            | |.|
 Frog   198 EIPPD 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 45/118 (38%)
metazoan_ACD 61..138 CDD:107247 36/85 (42%)
hsp30cXP_002944274.2 IbpA 41..188 CDD:223149 45/118 (38%)
ACD_HspB9_like 88..174 CDD:107236 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.