DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and LOC100491399

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002939080.1 Gene:LOC100491399 ID: Length:208 Species:Xenopus tropicalis

Alignment Length:191 Identity:50/192 (26%)
Similarity:81/192 (42%) Gaps:35/192 (18%)


  Fly     3 SLPMFWRMAEEMAR-MPRLSSPFHAF--FHEPPVWSVALPRNWQQIARWQEQEFAP-----PATV 59
            |..:|..:.:||.| :.::.|.|...  ||:..:..|.:          |:.:..|     .|..
 Frog    26 SRDVFSDLEQEMIRTVEKIKSSFDLMEQFHQKLLQEVTV----------QQNKTLPVLNGSDAKA 80

  Fly    60 NKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQG--GYSSRHFLRRFVLPEGYEAD 120
            ...|:.|.|.|:|:|  ||.||:|...:::...|..:....:|  .|..:.|.:...||.....|
 Frog    81 TDKGFTLCLGVEDFSPEELTVKLLGRKLLVTGAKESKCNDGKGSFSYKCQIFRKEADLPMNVRED 145

  Fly   121 KVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPA-----------KKSAEEPNDK 170
            |::.|::::|.|.|..|.  |:....:.|.|.|:.||.||           .|..|.||.|
 Frog   146 KLSCTMTAEGKLLIEAPE--GLSPAEEGRNVPIQLTGSPAITQATEGSSEGIKEPETPNPK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 36/148 (24%)
metazoan_ACD 61..138 CDD:107247 24/81 (30%)
LOC100491399XP_002939080.1 alpha-crystallin-Hsps_p23-like 84..163 CDD:294116 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.