DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hsp30d

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002937646.1 Gene:hsp30d XenbaseID:XB-GENE-5917036 Length:215 Species:Xenopus tropicalis

Alignment Length:135 Identity:50/136 (37%)
Similarity:70/136 (51%) Gaps:21/136 (15%)


  Fly    47 RWQEQEFAPPATVNKDG---YKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQ-EAEQGGY--S 103
            |..|.|...|:: .|||   ::|||||:|:|  ||.||:....|: |.||.|:: ::|.|.|  .
 Frog    77 RAAETEGTSPSS-GKDGKDHFELTLDVRDFSPHELTVKMQGRRVI-VTGKQERKSDSEDGSYFHE 139

  Fly   104 SRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN---PPGVQETLKEREVTIEQTGEPAKKSAE 165
            .|.:.|...||||...::|..:.|.||.|.|..|.   ||.     .||.:.|..  :||.:.|:
 Frog   140 YREWKREAELPEGVNPEQVVCSFSKDGHLHIQAPRLALPPA-----PERPIPISM--DPAPRDAQ 197

  Fly   166 E-PND 169
            | |.|
 Frog   198 EIPPD 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/118 (37%)
metazoan_ACD 61..138 CDD:107247 35/85 (41%)
hsp30dXP_002937646.1 IbpA 41..188 CDD:223149 44/118 (37%)
ACD_HspB9_like 88..174 CDD:107236 35/88 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65361898
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5040
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.840

Return to query results.
Submit another query.