DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and cryaa

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002944595.2 Gene:cryaa XenbaseID:XB-GENE-5940571 Length:171 Species:Xenopus tropicalis

Alignment Length:146 Identity:44/147 (30%)
Similarity:74/147 (50%) Gaps:21/147 (14%)


  Fly    18 PRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKV 80
            |.:||....|:.:      .|||.:     |...  ......::|.:.:.||||.:|  :|.||:
 Frog    38 PFMSSTLSPFYRQ------NLPRGF-----WDSG--ISEVRSDRDRFFINLDVKHFSPEDLSVKL 89

  Fly    81 LDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQE 144
            .|: .|.:.||..::: :..||.||.|.||:.||...:.:.|:.|||:||:|:.|.|. .|.|..
 Frog    90 HDD-FVEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQNSVSCTLSADGILSFSGPKLQPNVDS 152

  Fly   145 TLKEREVTI---EQTG 157
            :..:|.:.:   |::|
 Frog   153 SHSDRTIPVSREEKSG 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 42/142 (30%)
metazoan_ACD 61..138 CDD:107247 31/79 (39%)
cryaaXP_002944595.2 Crystallin 1..50 CDD:278926 4/12 (33%)
IbpA 20..148 CDD:223149 39/125 (31%)
alpha-crystallin-Hsps_p23-like 60..145 CDD:294116 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65239783
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.