DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryaa

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:111 Identity:38/111 - (34%)
Similarity:64/111 - (57%) Gaps:8/111 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPE 115
            |.|....::|.:.:.||||.:|  :|.||:.|: .|.:.||..::: :..||.||.|.||:.||.
 Frog     4 FVPQVRSDRDRFFINLDVKHFSPEDLSVKLHDD-FVEIHGKHNERQ-DDHGYISREFHRRYRLPS 66

  Fly   116 GYEADKVTSTLSSDGVLTISVPN-PPGVQETLKEREVTI---EQTG 157
            ..:.:.|:.|||:||:|:.|.|. .|.|..:..:|.:.:   |::|
 Frog    67 NVDQNSVSCTLSADGILSFSGPKLQPNVDSSHSDRTIPVSREEKSG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 30/78 (38%)
cryaaXP_031752202.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 5..89 CDD:469641 31/85 (36%)

Return to query results.
Submit another query.