DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and si:dkey-1k23.3

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio

Alignment Length:157 Identity:40/158 (25%)
Similarity:68/158 (43%) Gaps:50/158 (32%)


  Fly    24 FHAFFHEPPVWSVALPRNWQQIARWQEQEF-----------------AP------PATVNKD--- 62
            |:..|..||:..   ||:    ..|.|..|                 ||      ||..:|.   
Zfish    27 FNQHFGMPPLLE---PRD----LSWMEDIFRRLGTSSWPGYVRSGFLAPLLQASGPAVFSKPHRE 84

  Fly    63 -------------GYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFV 112
                         .:|::|||..:  :|:.||: ....:.:.||.|::: :..|:.:|.|.|::.
Zfish    85 LSGGVSEVAAETCRWKISLDVNHFAPAEISVKI-QHGFLEIAGKHEERQ-DGHGFIARSFTRKYN 147

  Fly   113 LPEGYEADKVTSTLSSDGVLTISVPNP 139
            ||.|.|.:.:.::||:||:||:..|.|
Zfish   148 LPGGIEVENLQTSLSADGILTVEAPFP 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 40/158 (25%)
metazoan_ACD 61..138 CDD:107247 26/95 (27%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.