DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and si:dkey-1k23.3

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:157 Identity:40/157 - (25%)
Similarity:68/157 - (43%) Gaps:50/157 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FHAFFHEPPVWSVALPRNWQQIARWQEQEF-----------------AP------PATVNKD--- 62
            |:..|..||:..   ||:    ..|.|..|                 ||      ||..:|.   
Zfish    27 FNQHFGMPPLLE---PRD----LSWMEDIFRRLGTSSWPGYVRSGFLAPLLQASGPAVFSKPHRE 84

  Fly    63 -------------GYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFV 112
                         .:|::|||..:  :|:.||: ....:.:.||.|::: :..|:.:|.|.|::.
Zfish    85 LSGGVSEVAAETCRWKISLDVNHFAPAEISVKI-QHGFLEIAGKHEERQ-DGHGFIARSFTRKYN 147

  Fly   113 LPEGYEADKVTSTLSSDGVLTISVPNP 139
            ||.|.|.:.:.::||:||:||:..|.|
Zfish   148 LPGGIEVENLQTSLSADGILTVEAPFP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 25/94 (27%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 88..172 CDD:469641 24/85 (28%)

Return to query results.
Submit another query.