DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb3

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:121 Identity:29/121 - (23%)
Similarity:54/121 - (44%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HAFFHEP-PVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVV 86
            |..|..| |..|....|...|:...||::         |.:|:.|||..:  .::.::|. |..:
 Frog    32 HMLFALPGPQCSDHKKREDGQLDDQQEED---------DKFKVLLDVVQFRPEDIIIQVF-EGWL 86

  Fly    87 LVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGV 142
            :::|: .....::.|:.||.|.|.:.||.|.....:::....||:|.:......|:
 Frog    87 IIKGE-HGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFFCHDGILAVEGKQKQGL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 19/78 (24%)
hspb3XP_002941074.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 55..137 CDD:469641 21/92 (23%)

Return to query results.
Submit another query.