DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb3

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis

Alignment Length:121 Identity:29/122 (24%)
Similarity:54/122 (44%) Gaps:14/122 (11%)


  Fly    25 HAFFHEP-PVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVV 86
            |..|..| |..|....|...|:...||::         |.:|:.|||..:  .::.::|. |..:
 Frog    32 HMLFALPGPQCSDHKKREDGQLDDQQEED---------DKFKVLLDVVQFRPEDIIIQVF-EGWL 86

  Fly    87 LVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGV 142
            :::|: .....::.|:.||.|.|.:.||.|.....:::....||:|.:......|:
 Frog    87 IIKGE-HGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFFCHDGILAVEGKQKQGL 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 29/122 (24%)
metazoan_ACD 61..138 CDD:107247 19/79 (24%)
hspb3XP_002941074.1 alpha-crystallin-Hsps_p23-like 55..137 CDD:294116 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65273411
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.