DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryaa

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:109 Identity:43/109 - (39%)
Similarity:59/109 - (54%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VNKDGYKLT--LDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119
            |..|..|.|  ||||.:|  ||.|||.|: .|.::||..::: :..||.||.|.||:.||...:.
Zfish    65 VRSDREKFTVYLDVKHFSPDELSVKVTDD-YVEIQGKHGERQ-DDHGYISREFHRRYRLPSNVDQ 127

  Fly   120 DKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKS 163
            ..:|.|||:||:||:..|...|:.....:|  ||..|.|....|
Zfish   128 SAITCTLSADGLLTLCGPKTSGIDAGRGDR--TIPVTREDKSNS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 34/80 (43%)
cryaaNP_694482.1 Crystallin 1..52 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..146 CDD:469641 35/82 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.