DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and pkdc

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio

Alignment Length:231 Identity:51/232 (22%)
Similarity:84/232 (36%) Gaps:60/232 (26%)


  Fly   132 ERDSIMFEDLSLERYKVACRVKKLDLEHTYL-------VLEKLADFHAAGAALAQRQPGIFEKNY 189
            |...|:.|||.:..:.|         ..||:       .|..:|:|||.                
Zfish   106 EEQLIVLEDLDVAGFPV---------RKTYVNDAEIKACLSWIANFHAL---------------- 145

  Fly   190 DRGFFNKHVRGYEPIMKN-ILKALSRTLDLSPDLKERYQA-KIDRLIDNVMDYGERSTSVAPGDF 252
               |.:....|..||... .|:.....|:...|.|.:..| :||.:::|..             |
Zfish   146 ---FLDVTPEGLWPIGTYWHLETRPEELEAMSDQKLKAAAGEIDSILNNCR-------------F 194

  Fly   253 VTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQ 317
            .|:.|||....|..|..|.    :....:|||:........|:.||..:.:.|....::...|:.
Zfish   195 KTIVHGDAKLANFCFSKDG----LQVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLD 255

  Fly   318 FYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYA 353
            :||.:|..:||:     || ...|.::::|....:|
Zfish   256 YYFSELRKSLEK-----KV-DFAELEKEWRNMFAFA 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 46/209 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 46/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66213
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.