DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CHKov2

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster

Alignment Length:421 Identity:100/422 (24%)
Similarity:184/422 (44%) Gaps:25/422 (6%)


  Fly     5 TTHNAPAWLTEEYVEKKLRVYFKNDTLNLK---KLTIKPATANGENYASVMTRISVEYITKDSKD 66
            |....|.|:|:|.....|    :....|.|   |.....|.:.||||.:::.||.:|...||: .
  Fly     2 TDQPTPQWVTKELFSSLL----EQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDN-S 61

  Fly    67 NQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATV---G 128
            .:..:::||.....:|.....   :.::..|:|||:.::|.|.|:.......|.|.....:   |
  Fly    62 IEDVSYILKIPLVPEDEKNDF---HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPG 123

  Fly   129 VDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGF 193
            ...:.|.|:.|||..:.|:.|.|.:.|:......||:|||.:|||.|.... :.|.:||:....:
  Fly   124 EPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVV-ELGEYEKDIRESY 187

  Fly   194 F-NKHVRGYEPIMKN----ILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFV 253
            | .:|.:..:....|    .|:.:.: .:|.|...........:|.|..:::|:..    |.:..
  Fly   188 FTTEHQKLLDEFNINFCMPFLECMQQ-YNLEPGQLVLISDYTSQLTDLNIEFGKND----PLELS 247

  Fly   254 TLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQF 318
            .|.|||.|..|.||:|.:.....:..|:|||...:.:||.||.....||...:::|::....:::
  Fly   248 VLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEY 312

  Fly   319 YFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEK 383
            |..:||..|..:.|:...|:|.:|.........:|...:....|.::.....:..|...|.:.|:
  Fly   313 YHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEE 377

  Fly   384 GVRLRDAVYQTEENLKKLHLTLPFLDQLGLL 414
            .:..:..::.....:.::.:.||:|...|.:
  Fly   378 AIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 77/296 (26%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 77/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55813
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.