DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG10562

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster

Alignment Length:436 Identity:118/437 (27%)
Similarity:201/437 (46%) Gaps:68/437 (16%)


  Fly    10 PAWLTEEYVEKKLRV----YFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSA 70
            |.|:|.|..|..|:.    |.|     :|.......:|.|||||::|.|:.:|...:|.| ::|.
  Fly     7 PDWVTAEIFEDLLKANVDGYSK-----IKNFKADIGSAAGENYATIMLRVKIEVELQDGK-SKSV 65

  Fly    71 TFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVD----- 130
            ::::|... ..:....::....|:..|..||.:::|.|..:.|            .||||     
  Fly    66 SYMVKLPH-QVEAIQEMMKRTNIFEIERTMYNEVVPELEALYK------------AVGVDITFGA 117

  Fly   131 -------RERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAA-LAQRQPGIFEK 187
                   .:.|.:..|||.|:.:|.|.|::.||.|||..||.||:.:|||.|. :|.:.|  :.|
  Fly   118 KNYDLKNAKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGP--YPK 180

  Fly   188 NYDRGFFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRL-------IDNVMDYGERST 245
            ...:|||.:..|   |:|..::|.:......|....|.::|.:|::       ||.:.::.:   
  Fly   181 ILLQGFFKEESR---PVMSEMIKGMGANFVKSCATYEGHEAYLDKVKALQPVAIDKIFEFAK--- 239

  Fly   246 SVAPGDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLE 310
             |.|.:|..|.|||.|:.|:|||||..|.......:|:|...:.:.|.||.||..:|.....:|.
  Fly   240 -VEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLA 303

  Fly   311 RQTELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFY------AVFASLIFEPTMVYNGK 369
            :....::.|...||..|:.:|||..:|||.:........|::      .|.::::.:||      
  Fly   304 KFDYYIKIYHDNLVEHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPT------ 362

  Fly   370 EEPSIEQFMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415
            :..|:|.|:...:..::|    |.:....|.:...:|:|...|.|:
  Fly   363 DSASLENFIGGSDFQMQL----YNSPRYRKHIQAVMPWLLNRGALE 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 89/308 (29%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 89/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55984
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.