DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG31087

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster

Alignment Length:442 Identity:123/443 (28%)
Similarity:215/443 (49%) Gaps:54/443 (12%)


  Fly     1 MPEKTT--------HNAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTR--I 55
            |.|.||        :|.|:||::..:||.::... .|...:..:..:..:::|:||::...|  :
  Fly     1 MSEATTNGHNEVPANNLPSWLSKISLEKAVQAQI-GDFEKIISVIPQKGSSDGDNYSTQFLRLLV 64

  Fly    56 SVEYITKDSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRL----ADIVKNEL 116
            .||.|...:||   .:|:||...:::..|| :|....::.:|..||..|||:.    ||..| .:
  Fly    65 EVELIDHSTKD---LSFVLKAQHSNEMMAA-ILAKLKLFQKEEQMYHSILPKFEKLYADAGK-PI 124

  Fly   117 HDSRKLFAATVGVDRER--DSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQ 179
            ..:.|.|.    .||:.  |.|:.|||..:.:|.|.|:..|||:|.:.||||||.||||.|...:
  Fly   125 QFAPKAFK----FDRDLGVDYILLEDLHRKNFKNANRLAGLDLDHMHKVLEKLAAFHAASACYVE 185

  Fly   180 RQPGIFEKNYDRGFFNKHVRGYEPIMKNILKALSRTLDLSPDLK---------ERYQAKIDRLID 235
            .. |:|.:.:..|.|::..|       .:|:..:.:......||         |:.....|.|:|
  Fly   186 HH-GLFGEEFTVGVFSESNR-------QLLQEFNASGAFLAQLKKWKNAQKIYEKLADSDDYLVD 242

  Fly   236 NVMDYGERSTSVAPGDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFS 300
            .::...:.:|.    :|..|.|||.|..|||:|:|..|.....:|:|||...:.|||.||.|...
  Fly   243 RLLQDQQYNTR----EFNVLNHGDCWANNVMYQHDAFGTIKETLFVDFQVGKYGSPANDLYYLIL 303

  Fly   301 TSIHENLRLERQTELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGF--YAVFASLIFEPT 363
            :|....|:..:...||::||..|:..|:.::|...:|.|..........|.  |.|.:.::  |.
  Fly   304 SSAAPELKTAKFDYLVRYYFDNLIENLKLLQYHRPLPKLKNLHASLFRNGLAAYMVVSKVL--PV 366

  Fly   364 MVYNGKEEPSIEQFMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415
            ::.:...:.::|.:::.:.|   :::|::...:.::.:...||:||..||||
  Fly   367 VMLDKTADANLESYISDESK---MKNAMFTNPKYVQVMTEVLPWLDNRGLLD 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 94/305 (31%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 94/304 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56023
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.