DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG10550

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster

Alignment Length:428 Identity:125/429 (29%)
Similarity:207/429 (48%) Gaps:33/429 (8%)


  Fly     2 PEKTTHNAPAWLTEEY----VEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITK 62
            |.:..| .|.|:.|||    :||.:..:.|  .:||..:.   |||.||||.|:|.|:.|:.:.|
  Fly    13 PNEHLH-IPKWINEEYFQPIIEKDVENFDK--IINLVPIA---ATAPGENYTSIMIRVIVDILLK 71

  Fly    63 DSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKN---ELHDSRKLFA 124
            |..: |..:::|| |..:.|..|.::...|::.:|..|||..:|:...:.|.   |:..:.|  .
  Fly    72 DGSE-QRVSYILK-TMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPK--C 132

  Fly   125 ATVGVDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNY 189
            ..|....|..:::|||||.:.:|...|:|..||.|...||.|||:.||| :.:|:...|.::..|
  Fly   133 LHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAA-SVVAKEINGPYDAMY 196

  Fly   190 DRGFFNKHVRG-YEPIMK----NILKALSRTLDLSPDLKERYQAKIDRLID--NVMDYGERSTSV 247
            :...:|:..|. :|.:.|    ..|||: |..||     |..::.|.|:.|  .|.:...:...|
  Fly   197 NMSIYNEQSRDLFESLGKQREEQFLKAM-RNWDL-----ENAESYIARMWDPLEVFEEAVQVNQV 255

  Fly   248 APGDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQ 312
            ...:|..|.|||.|:.|:||.|.|.|.....|.:|.|...|.|||.||.|..:||...:::::..
  Fly   256 DEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEF 320

  Fly   313 TELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASL-IFEPTMVYNGKEEPSIEQ 376
            ...:|.|..:|...|:.:.||..:|:|.:........||:....:: :...|::...| :.:::.
  Fly   321 DHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDK-DANMKM 384

  Fly   377 FMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLL 414
            .:....:...:|...:......|.:.:.|||.|..|||
  Fly   385 ILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 93/298 (31%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 93/298 (31%)
APH 108..338 CDD:279908 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55789
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.