DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG13659

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:433 Identity:108/433 - (24%)
Similarity:186/433 - (42%) Gaps:52/433 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATF 72
            |.|.||..:::.:.||.|.|:..|.:..|:..||:|.|::|||:|.|..|||..::.  |.:.:.
  Fly    12 NPPEWLNVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRARVEYTAQNG--NFTKSL 74

  Fly    73 LLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIM 137
            ::||...::.....:..:..::|.||.||.::||....|:: ..:|..||:...:....:...|:
  Fly    75 IIKTMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWERILR-RANDPAKLYVECIYHSLQPHQIL 138

  Fly   138 -FEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQ--------------PGIFEK 187
             |:||....|.|. |.:.|..|.......|||..||........|              ||:.:.
  Fly   139 IFDDLVEMGYAVV-RDRFLTREEISSAYSKLAKIHAISMKFIHEQPEYLKEFKNGLCEMPGLIDS 202

  Fly   188 NYDRGFFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQ---AKI-----DRLIDNVMDYGERS 244
            :...|       |.:|.|    :.|.|..:||     :||   .||     |||.:.:.:|   .
  Fly   203 SIISG-------GMDPFM----EMLGRIPELS-----KYQPHFKKISLHFKDRLRETMQEY---R 248

  Fly   245 TSVAPGDFVTLAHGDIWTTNVMFQYDDE-GHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLR 308
            .:..|| :..|.|.|..:.|:||:.:.| |...:.:.:|:|.......|:||.|.....:....|
  Fly   249 NNPQPG-YNVLCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGPAQR 312

  Fly   309 LERQTELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPS 373
            .|....|:.:|...|:..|:::.|.|.:|:...|..:.:...:|.......|.|..:.....:..
  Fly   313 REELDILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSIGLRTHKLD 377

  Fly   374 IEQFMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLDE 416
            |...|.::|    .|..:||.|:.:::....|....:.|..|:
  Fly   378 IGDMMHNEE----TRKKLYQLEDFMEETKSILDRFQKSGYFDD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 78/311 (25%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 78/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.