DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG13658

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster

Alignment Length:426 Identity:121/427 (28%)
Similarity:191/427 (45%) Gaps:35/427 (8%)


  Fly     8 NAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATF 72
            :|||||..|.:|..||.|.|:..|::..|.|.|||..|::|||||.|....|.|  :|.|.|...
  Fly    16 DAPAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYST--AKGNFSKAL 78

  Fly    73 LLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIM 137
            ::||....:.....:|.|..|:..||.||.:.||.|..|:: |..|:.||:|..:....|...:|
  Fly    79 IVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILR-EAGDTTKLYAPCIYHSLEPHQVM 142

  Fly   138 -FEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRG------FFN 195
             ||||..:.|.| .|.:..:.|.......|||.:|||...:...:|. |.|.:..|      |.|
  Fly   143 IFEDLVPQGYTV-IRDRYPNKEELQKAFFKLAKWHAASMKVLNERPD-FLKEFKYGLWGMPNFLN 205

  Fly   196 KHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDN-------VMDYGERSTSVAPGDFV 253
                  :.|:...:......||..|:| .:|:...:::.||       ||:  |..|:..|..:.
  Fly   206 ------DSIVTTGVPCFLEMLDKVPEL-TKYKPYFEKIKDNYIQQMSAVME--EYRTNPKPNRYY 261

  Fly   254 TLAHGDIWTTNVMFQYDDE-GHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQ 317
            .|.|||....|:||:|:.| |...:.:.:|||.|.....:|||.|.....:....|.:...|.:.
  Fly   262 VLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEYIN 326

  Fly   318 FYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTM-VYNGKEEPSIEQFMTSD 381
            :||..|...|:::.:.|::|:.....:.......|..|....|.|.: ..|.|...|::.|....
  Fly   327 YYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSMDSFFDPQ 391

  Fly   382 EKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLDEM 417
            .|     ...:..:|.:..:.:.|...::||...::
  Fly   392 TK-----QKSFFLDEYITDVKMLLRKFEELGYFKDL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 89/303 (29%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 89/303 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63183
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.