DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG9498

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster

Alignment Length:423 Identity:121/424 (29%)
Similarity:201/424 (47%) Gaps:24/424 (6%)


  Fly     8 NAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYIT----KDSKDNQ 68
            :.|.:|.|.:..:.|....:...:.||::.....:..|:||.|.:.|:.|.:..    .:|...:
  Fly    11 SVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGESPVTE 75

  Fly    69 SATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRER 133
            ..:.::||....:  |...|.:..::.:|...|..:||||..:.:.:...::...:....|    
  Fly    76 QLSLIVKTIPITE--ATQFLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPV---- 134

  Fly   134 DSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHV 198
            .:|:|.||::|.:|||.|.|.||..|..|:|::|..|||....||::.|.|. |.|.||..::.:
  Fly   135 QTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIV-KQYTRGMLSEDI 198

  Fly   199 ----RGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGD-FVTLAHG 258
                ..:|.:....||.|.:: ..|....|:....:.||:||..:....:.....|| :|.|.||
  Fly   199 LMKSDTFEQMFGGFLKGLIKS-SASWAGYEKISKHLQRLMDNFRNVCADAPRPRKGDRYVVLNHG 262

  Fly   259 DIWTTNVMFQYDDEGH---PVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYF 320
            |:||.|.|:.||:...   |..|||:|||.|.:.|||.||.:|.:|||...|..||:.||::.|:
  Fly   263 DLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYY 327

  Fly   321 YKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEP--TMVYNGKEEPSIEQFMTSDEK 383
            .....|||..::. .:||..:.|.:.|::..|.:|....|.|  ||.....::.|||. |..:..
  Fly   328 ASFKDALEYARFE-DIPSYEDLQYELRSRETYGLFGMFAFLPMITMPKELAQDNSIEN-MQDEAF 390

  Fly   384 GVRLRDAVYQTEENLKKLHLTLPFLDQLGLLDE 416
            ..|..||::..:.........|...|.||:..:
  Fly   391 KQRKMDAIFSQKFLNDHQKWALKRADSLGVFGD 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 94/300 (31%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 94/300 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59925
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.