DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG33509

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:356 Identity:76/356 - (21%)
Similarity:132/356 - (37%) Gaps:126/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 REIDMYEQILP-RLADIVKNELHDSRKLFAATVGVDRERDSIMFED-------LSLERYKVACRV 152
            |||:::.:.:| :.|::.|..:.              :::|.:::.       ||..::...|..
  Fly    57 REIELFVKAMPQQSAELSKESIF--------------QKESWLYDTLIKKLQALSNVKWSPNCVY 107

  Fly   153 KKLDLEHTYLVLE--KLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRGYEPIMKNILKALSRT 215
            .:.||    :|||  ||..|.:||:|         |.|             |..:|.::|:::..
  Fly   108 SRKDL----MVLENIKLKGFTSAGSA---------ELN-------------EVFVKPLIKSIAAF 146

  Fly   216 LDLSPDLKERYQAKI-------DRLIDNVMD-----------------------YGERSTSVAPG 250
              .|..|...:|.|.       |.|::..:|                       .|.|..|.. |
  Fly   147 --HSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFI-G 208

  Fly   251 DFV-------------------TLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQ 296
            |.:                   .|.|.|||..|:.|..::.|   .|:.||||...:..||.||.
  Fly   209 DKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSG---PALLIDFQTCRYAPPASDLN 270

  Fly   297 YFFSTSIHENLRLERQTELVQFYFYKLV-----VALERVKYSGKVPSLFEFQQQFRTKG--FYAV 354
            :....::..:.|.:.:.:.:..|...|:     :.||.:..|..  .|.|..::||..|  :.||
  Fly   271 FCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKS--ELLESYEEFRLFGVVYRAV 333

  Fly   355 FASLIFEPTMVYNGKEEPSIEQFMTSDEKGV 385
            .|:::..||            .|:|:|.|.|
  Fly   334 AATVVKVPT------------DFITNDFKYV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 60/299 (20%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 55/287 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459491
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.940

Return to query results.
Submit another query.