DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG33509

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster

Alignment Length:358 Identity:79/359 (22%)
Similarity:131/359 (36%) Gaps:130/359 (36%)


  Fly    96 REIDMYEQILPRLADIVKNE--------LHDS--RKLFAATVGVDRERDSIMFEDLSLERYKVAC 150
            |||:::.:.:|:.:..:..|        |:|:  :||.|                ||..::...|
  Fly    57 REIELFVKAMPQQSAELSKESIFQKESWLYDTLIKKLQA----------------LSNVKWSPNC 105

  Fly   151 RVKKLDLEHTYLVLE--KLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRGYEPIMKNILKALS 213
            ...:.||    :|||  ||..|.:||:|         |.|             |..:|.::|:::
  Fly   106 VYSRKDL----MVLENIKLKGFTSAGSA---------ELN-------------EVFVKPLIKSIA 144

  Fly   214 RTLDLSPDLKERYQAKI-------DRLIDNVMD-----------------------YGERSTSVA 248
            ..  .|..|...:|.|.       |.|::..:|                       .|.|..|..
  Fly   145 AF--HSASLVYEHQTKTNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFI 207

  Fly   249 PGDFV-------------------TLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAID 294
             ||.:                   .|.|.|||..|:.|..::.|   .|:.||||...:..||.|
  Fly   208 -GDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSG---PALLIDFQTCRYAPPASD 268

  Fly   295 LQYFFSTSIHENLRLERQTELVQFYFYKLV-----VALERVKYSGKVPSLFEFQQQFRTKG--FY 352
            |.:....::..:.|.:.:.:.:..|...|:     :.||.:..|..  .|.|..::||..|  :.
  Fly   269 LNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKS--ELLESYEEFRLFGVVYR 331

  Fly   353 AVFASLIFEPTMVYNGKEEPSIEQFMTSDEKGV 385
            ||.|:::..||            .|:|:|.|.|
  Fly   332 AVAATVVKVPT------------DFITNDFKYV 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 63/302 (21%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 58/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61629
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.