DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG33510

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster

Alignment Length:443 Identity:97/444 (22%)
Similarity:168/444 (38%) Gaps:66/444 (15%)


  Fly     2 PEKTTHNAPAWLTEEYVEKKLR--VYFKNDTLNLKKLTIKPATAN----GENYASVMTRISVEYI 60
            |..|..|.....|.|...|.|.  :..||:...|....|.|||.:    ||.:     .:..:|.
  Fly     8 PVFTRENRTELFTLEECNKILANLLADKNEQGVLLNFNIVPATEHTGFLGEYF-----HLYFQYQ 67

  Fly    61 TKDSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHD-SRKLFA 124
            .:|.||.|::...:|:...........:...|:..:||.:|:.:         |||.. |:.:::
  Fly    68 LEDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLYDLL---------NELKKFSKHVWS 123

  Fly   125 ATVGVDRERDSIM--FEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQP---GI 184
            |.....|:...:|  .||:.........|.  |:......:|:.||..||:..|..::|.   |:
  Fly   124 AKCYFTRKDLFVMQNVEDMGYVALPPGTRF--LNENQMGPILKSLATLHASSIAYEKQQGKTIGV 186

  Fly   185 -FEKNYDRGFFNKHVRGYEPIMKNILKALSRTLDL--SPDLKERYQAKIDRLIDNVMDYGERSTS 246
             |.|.......:..|..|...::.:|...:...|:  :|:.:|....::.|.:|.|.    ...:
  Fly   187 EFRKWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNPEAQEYIAQELPRCLDKVY----CMVN 247

  Fly   247 VAPGDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLER 311
            .:|.......|.|.|..|| |.:.::.|...:|.:|||...::.||:|.......::....|.:.
  Fly   248 PSPVHRNVFVHRDAWNANV-FYHKEKPHEERSILVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKM 311

  Fly   312 QTELVQFYFYKLVVALERVKYSGKVP-----SLFEFQQQFRTKGFY-----AVFASLIFEP-TMV 365
            ...|::.|:..|.   |..:..|..|     |..||:|.......:     .:.|:::..| ..:
  Fly   312 IGSLIETYYDALA---EEFREMGVNPYQEQLSKQEFEQSLNDFSLFGATYNCIAATVLRLPDNYL 373

  Fly   366 YNGKEE--PSIEQFMTSDEKGVRLR---------DAVYQTEENL-----KKLH 402
            .|.|:|  ....:|...|.....||         |.:|....:|     .|||
  Fly   374 KNLKDERPEDFHRFCNVDRSADVLRLMKNHPEFADYMYDCVGDLLALTYHKLH 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 62/301 (21%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 44/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61688
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.