DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG5126

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster

Alignment Length:479 Identity:104/480 (22%)
Similarity:197/480 (41%) Gaps:109/480 (23%)


  Fly    16 EYVEKKLRVY--FKN--DTLNLKKLTIKPATANG-ENYASVMTRISVEYITKDSKDNQSATF-LL 74
            :|:|:.| ||  |||  .:.:|:..:::  .:|| :.:.|.:..::::.:..:.|..:.... .:
  Fly     9 DYIERHL-VYDIFKNFGPSASLESHSVE--CSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFM 70

  Fly    75 KTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKL-----------FAATVG 128
            |.|...::.:.    :|..::.||..|.:|||...::::....:|..:           |....|
  Fly    71 KGTEEFRESSN----SYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEG 131

  Fly   129 VDRERDSIM-FEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQP---------- 182
            :...|:|:: .:.|..:.|::..|: .|..:....::..:..|||.|.|....||          
  Fly   132 LGNGRESVLALKHLKGDGYQLGPRL-TLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGV 195

  Fly   183 -----------GIFEKNYDRGFFNKHVRGYEPIMKNILK--------ALSRTLDLSPDLKERYQA 228
                       |||:..| |..|::....|:...:.:|:        |:.|       |:|:|..
  Fly   196 VDMPFVSSSGKGIFDVLY-RVAFDRFYEFYDRQKEQLLQGADPGFGAAIER-------LREKYFK 252

  Fly   229 KIDRLIDNVMDYGERSTSVA----PGDFVTLAHGDIWTTNVMFQYDDEGHPVNAI-FIDFQFSVW 288
            :...|::.:     |::|.|    ...|.|..|||....||:|.|..| ..|:|| .||||...:
  Fly   253 QPTLLLERI-----RTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAE-DKVDAIKAIDFQELRF 311

  Fly   289 NSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALERV------------------KYSGK 335
            ::.||||.:|...:.....|.|...:|::.|...::..||.|                  :||  
  Fly   312 STTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYS-- 374

  Fly   336 VPSLFE-FQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKGVRLRDAVYQT----- 394
                || |...|:...||.....:.|.|.::...|:...:.:...:|..|    .|.:|.     
  Fly   375 ----FERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHG----PAFHQLSLDIA 431

  Fly   395 -EENLKKLHLTLPFLDQLGLLDEM 417
             :|..:::..|:....:.|.:||:
  Fly   432 GDEANQEIFKTVRHAYEHGYMDEI 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 75/354 (21%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 72/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.