DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG31099

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:357 Identity:94/357 - (26%)
Similarity:165/357 - (46%) Gaps:35/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADI---VKNELHDSRKLFAA--TVGVDR 131
            ||||.... .|..|.::....::.||..:|..:||:|.:|   |..::....:.|..  ::||  
  Fly    66 FLLKAQHG-TDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGV-- 127

  Fly   132 ERDSIMFEDLSLERYKVACR---VKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGF 193
              ..::.|||..:.||...|   ..||.|:.   ||:|||.||||.|...::. |.|......|.
  Fly   128 --QYVLLEDLKAKSYKNVERQAGFNKLCLKQ---VLKKLAQFHAASAVCVEKH-GAFSNLLVNGV 186

  Fly   194 FNKHVRGYEPIMK-----NILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFV 253
            :.|   ..|.:::     .|..:..|...|.....:|...|...|:|.::    :..|....:|.
  Fly   187 YTK---ANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLL----KLHSPDSNEFN 244

  Fly   254 TLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQF 318
            .|.|.|.|..||||::||.||..:...:|:|...:.||||||.|...:|..::::|.:...:||:
  Fly   245 VLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQY 309

  Fly   319 YFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEK 383
            |||.|:..|:.:.:.|.:|.|...:......|..|........|..:.|..|:...|::.:    
  Fly   310 YFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERYAS---- 370

  Fly   384 GVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415
              :::.|::.:.:.::.:...||::::..||:
  Fly   371 --KMKCAMFTSRKYIQAIKDILPWMEERSLLN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 80/272 (29%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 80/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.