DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG31436

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster

Alignment Length:412 Identity:101/413 (24%)
Similarity:183/413 (44%) Gaps:18/413 (4%)


  Fly    10 PAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATFLL 74
            |.||..|::.:.|........:.:..||..||:|.|::|||:|.|..|:|..:..:..:|  .::
  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNRKGEFQKS--LII 80

  Fly    75 KTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIM-F 138
            ||....:.....:|....|:..|:.:|.::||....|:: ::.|..:|:...:....|...:: |
  Fly    81 KTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILR-QVGDDTQLYVNCIYHSLEPHQVLIF 144

  Fly   139 EDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFN-KHVRGYE 202
            |||:...| :..|.:...|:....:..|||.:||....:...||...| :|..|.|. .||.. :
  Fly   145 EDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLE-SYTHGLFEMPHVLN-D 206

  Fly   203 PIMKNILKALSRTLDLSPDLKERYQAKIDRLIDN-----VMDYGERSTSVAPGDFVTLAHGDIWT 262
            |.|:..::.....|...|:| .:|:...:.:.|:     |.::.:...|....::..|.|||:..
  Fly   207 PFMRTGMEFFVELLGKEPEL-NKYKPYFESIKDDFLERLVEEWKDIRKSQKKDEYWVLCHGDLHL 270

  Fly   263 TNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVAL 327
            .|:||::.|.....:.:.:|||.|.......||.|.....:....|.....:|:.:|...|...|
  Fly   271 RNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVL 335

  Fly   328 ERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKGVRLRDAVY 392
            :::.|.|.:||.....::.....:|..|....|.|.|.....:.......:.::||    |....
  Fly   336 KKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRDKSVDFGDLLQNEEK----RRKCS 396

  Fly   393 QTEENLKKLHLTLPFLDQLGLL 414
            .::..:|::.:.|..|||||||
  Fly   397 FSKGYIKEVTILLARLDQLGLL 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 70/295 (24%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 70/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63248
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.