DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and CG33301

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster

Alignment Length:408 Identity:165/409 (40%)
Similarity:248/409 (61%) Gaps:7/409 (2%)


  Fly    10 PAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKD-SKDNQSATFL 73
            |.|||..|::.:||.|.::|.|.:.::..||||..|||:..|||||.|:|...| |..|:  |::
  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNK--TYI 65

  Fly    74 LKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIMF 138
            :|...:.:.|.|.:...|.:||||:||||.|||:|.:::: |....:||.|..:.||||.::::.
  Fly    66 VKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQ-EAGLDQKLTADAITVDREYNTMIL 129

  Fly   139 EDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRGYEP 203
            |||:..::..|.|||:||:.||.|.||.||.||||...|.:|.|.:..|.:...||::..:.|..
  Fly   130 EDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSV 194

  Fly   204 IMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAHGDIWTTNVMFQ 268
            :...:.||..|.:|..|:|||.|..|:.:|..::|:||.|:..|...|..||.|||.||||:|||
  Fly   195 VFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWTTNIMFQ 259

  Fly   269 YDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALERVKYS 333
            |||.|.|.:.:.||||||...||.|||.|||:||:.|.:. ::::|||:.::..|...||:..|.
  Fly   260 YDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVG-DKESELVEHHYKALKANLEKFSYK 323

  Fly   334 GKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPS-IEQFMTSDEKGVRLRDAVYQTEEN 397
            |.:|:|.|::.||..:.|.::.|.: |:|.|:|||.||.| .........:|:|.:.:||.:|..
  Fly   324 GSLPTLQEYRLQFERRRFMSLLAHM-FKPCMIYNGSEETSDFSSLYAESPEGLRYQKSVYASEAV 387

  Fly   398 LKKLHLTLPFLDQLGLLD 415
            ::.....|..||..|||:
  Fly   388 IRSATKLLAILDAKGLLE 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 122/289 (42%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 122/289 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130764182
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4038
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.