| Sequence 1: | NP_001287526.1 | Gene: | CG11889 / 3772506 | FlyBaseID: | FBgn0039308 | Length: | 417 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001285793.1 | Gene: | CG33301 / 2768917 | FlyBaseID: | FBgn0053301 | Length: | 407 | Species: | Drosophila melanogaster |
| Alignment Length: | 408 | Identity: | 165/408 - (40%) |
|---|---|---|---|
| Similarity: | 248/408 - (60%) | Gaps: | 7/408 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 PAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKD-SKDNQSATFL 73
Fly 74 LKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIMF 138
Fly 139 EDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRGYEP 203
Fly 204 IMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAHGDIWTTNVMFQ 268
Fly 269 YDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALERVKYS 333
Fly 334 GKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPS-IEQFMTSDEKGVRLRDAVYQTEEN 397
Fly 398 LKKLHLTLPFLDQLGLLD 415 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11889 | NP_001287526.1 | EcKinase | 44..332 | CDD:281023 | 122/288 (42%) |
| CG33301 | NP_001285793.1 | EcKinase | 37..322 | CDD:281023 | 122/288 (42%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45449871 | |
| Domainoid | 1 | 1.000 | 166 | 1.000 | Domainoid score | I7989 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 1 | 1.000 | - | - | H115919 | |
| Inparanoid | 1 | 1.050 | 53 | 1.000 | Inparanoid score | I4082 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000277 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11012 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X109 | |
| 8 | 7.990 | |||||