DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and nhr-246

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans

Alignment Length:410 Identity:84/411 (20%)
Similarity:148/411 (36%) Gaps:98/411 (24%)


  Fly    20 KKLRVYFKNDTLNLKKLTIK-PATANG----ENYASVMTRISVEYITKDSKDNQSATFLLKTTFA 79
            :|:|::|.||.|. |.:.:| |....|    ||....:..:....:.:...:.:...:.|.::.:
 Worm    48 RKVRLHFDNDDLP-KHVVLKIPQNTKGCSVVENAGGGVKNVDHSVVERFMHNTECNYYKLFSSLS 111

  Fly    80 DKD---PAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIMFEDL 141
            :|.   |..:|....|   .:..:...:|..|.|.   :|||....|.              || 
 Worm   112 EKPLQIPTTYLASKAG---EKAPVPVIVLEMLEDC---KLHDLIPGFN--------------ED- 155

  Fly   142 SLERYKVACRVKKLDLEHTY-LVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVR------ 199
              :.:|:...:.||   |.: |..||..:.....:.||.           .||....|.      
 Worm   156 --QLFKIVDELVKL---HIFSLTTEKWKEIVPDESKLAM-----------SGFLQCMVADVGRKL 204

  Fly   200 GYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAHGDIWTTN 264
            ...|.:..||..:..|||..|:..::.:   |..|:      |...||       :.|||:|...
 Worm   205 AQNPELGVILSYVENTLDTDPNYLQKMR---DEYIN------EERPSV-------ICHGDLWAPQ 253

  Fly   265 VMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVAL-- 327
            :::..:|.    .|..:|:|.:...||..||.:..||......|......|:..|:.||.|.|  
 Worm   254 ILWDKEDN----IAGIVDWQATHRGSPMEDLHHILSTCTSVQNRKTFTKPLLDHYYNKLKVGLKE 314

  Fly   328 ---------ERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEK 383
                     |.:........::...:.....||:|      ..|.:..:||.:|.     ...|.
 Worm   315 KGFKTTWTREEIDIEYNYSFIYGASRTIFANGFWA------NSPVLQTDGKPDPE-----RIKES 368

  Fly   384 GVRLRDAVYQTEENLKKLHL 403
            .||.:..:   |:.:::|::
 Worm   369 FVRCKSYL---EDTIRELNI 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 63/313 (20%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.