DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and H37A05.2

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans

Alignment Length:415 Identity:85/416 (20%)
Similarity:155/416 (37%) Gaps:123/416 (30%)


  Fly    46 ENYASVMTRISVEYITKDSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLAD 110
            ||..::..||:|:..::.|..|.|.....:|...:|..:...|:. .::.||:|||..|:     
 Worm    67 ENAQNLPDRIAVKMSSELSLYNFSTLVSSETWDIEKMKSMTSLVK-ELHNREVDMYRIIM----- 125

  Fly   111 IVKNELHDSRKLFAATVGVDRERDSIMFEDLSLERYKVACRVKK------------------LDL 157
                    ..|....||.|           ||||.:.....:|.                  :.:
 Worm   126 --------REKPACPTVNV-----------LSLEAFTELSPLKAYIISEYIPNLHHVGMNDCISI 171

  Fly   158 EHTYLVLEKLADFHAAGAALAQRQP------GIFEKNYDRGFFNKHVRGYEPIMKNILKALSRTL 216
            |..:.|::.:|.|.|.|.::::.:.      .|:.:...:.||:                     
 Worm   172 EEIWAVVDGIAAFSAMGESMSEDEKKKSTIGEIYIEEAVKYFFD--------------------- 215

  Fly   217 DLSPD---------LKERYQAKIDRLIDNVMDYGERSTSVAP---------GDFVTLAHGDIWTT 263
            |.|||         |...|:.|::..:| :.|....|:.:..         |....|.|.|||.:
 Worm   216 DQSPDNMRKNLIMILGVAYEEKVEEAMD-IFDLYCGSSEIQKNYSRVSAFLGHSPVLMHSDIWPS 279

  Fly   264 NVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALE 328
            |::|....|........||||.:..:||.:|:.....|.:.:..|...|:|::..|:...|.:| 
 Worm   280 NLLFSLSSENKLEFKALIDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQSEILDRYYKSFVKSL- 343

  Fly   329 RVKYSGKVPSLFEFQQQFRTKGFYAVF-ASLIFEPTMVYNGKEEPSIEQFMTSDEKGVRLRDAVY 392
                  |.|:...:.::.....:...| ||:|.   |:      |.|..|      .|:|.:.: 
 Worm   344 ------KTPNSIPYTREQLEDSYELCFPASVIL---ML------PFILSF------SVKLGENI- 386

  Fly   393 QTEENLKKLHLTLPFLDQLGLLDEM 417
             .||:::|:         .||::::
 Worm   387 -NEESVEKM---------AGLIEDL 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 68/328 (21%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:285194 85/416 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4038
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.