DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11889 and F58B4.5

Sequence 1:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans

Alignment Length:346 Identity:80/347 (23%)
Similarity:130/347 (37%) Gaps:83/347 (24%)


  Fly    93 IYTREIDMYEQILPRLADIVKNELHDS---RKLFAATVGVDRERDSIMFED-------LSLERYK 147
            ::.||:..|:        |:..|.|..   .|::|          |..|:|       |..|.|.
 Worm   114 LHNREVATYK--------ILMREKHPKIPFTKVYA----------SKPFDDENKLKAYLISEYYP 160

  Fly   148 VACRV---KKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRG------FFNKHVRGYEP 203
            ....:   :.:..|....|:..:|.|.|.|..|::.     |..|.||      .|.:.:.....
 Worm   161 NIHHIGMHESIPAEDLIPVIHAIAAFSAIGMKLSEE-----ETKYARGADFLDIVFGQFMDEKSI 220

  Fly   204 IMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDY--------GERSTSVAPGDFVTLAHGDI 260
            ...|:|        |.....|.|..|::.::....||        ..::|....|....|.|.|:
 Worm   221 ERMNVL--------LKASFPEEYLEKVEEMLKIYKDYYFQPQMIKNFKNTCQFFGYKPVLTHSDL 277

  Fly   261 WTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVV 325
            |::|.:...|.|...:.|| ||||.....:||.|:...|::.:....|.|:...|::.|:...|.
 Worm   278 WSSNFLCTRDGEKVTLKAI-IDFQTVSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVN 341

  Fly   326 ALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNG------------KEEPSIEQFM 378
            .|:.:    .||  :.|||   .|..|.|:..|:  .|||..|            :.:.|::|..
 Worm   342 ELDGM----DVP--YTFQQ---LKDSYQVYFPLM--TTMVLPGIAPMLQHSNVTEEYKDSMKQVA 395

  Fly   379 TSDEKGVRLRDAVYQTEENLK 399
            .....|: |.|.:...|.|:|
 Worm   396 LDKMIGL-LEDVITTHESNIK 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 59/266 (22%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:285194 79/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4038
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.