DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and ASIC5

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 HGNCID:17537 Length:505 Species:Homo sapiens

Alignment Length:66 Identity:16/67 (24%)
Similarity:27/67 (40%) Gaps:20/67 (30%)


  Fly    23 GRVGVLRWLHTLWSLFLLMYIWTGSIVKCLEFTVEIPTIEKLLYLMEFPGNMATIAILVYYAVLN 87
            |.|.::.|  .::...|..:.|..:.      ::|:..:||    ||||.        |.:..||
Human    71 GSVSLVTW--QIYIRLLNYFTWPTTT------SIEVQYVEK----MEFPA--------VTFCNLN 115

  Fly    88 R 88
            |
Human   116 R 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 16/67 (24%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.