DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and ppk26

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_648125.3 Gene:ppk26 FlyBaseID:FBgn0035785 Length:597 Species:Drosophila melanogaster

Alignment Length:135 Identity:30/136 (22%)
Similarity:52/136 (38%) Gaps:27/136 (20%)


  Fly   278 LWEESVLLVYRLLWLAMHGGRIWFILSV---------------NEQIL----EQKCNLCQL-LNE 322
            |.|:...|:.||.|:::      .:|||               |..::    |:...:.|: ...
  Fly    86 LGEKKRPLLERLFWISV------LVLSVFTCVKLTLNIWDKWNNNPVIVSFAEKSTPVWQIPFPA 144

  Fly   323 LEVC-SSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTRSLGGFIGVLMAIVIFLIQIGLGNKSL 386
            :.|| .::.:|.|..|.....:..|......|||.|..:..|.:..|.......|..:.||||:.
  Fly   145 VTVCPETKTRREIFNFTDSYHQVRDFQSNVSGIVDLSDKQKGLYGAVSQVCEPHLHDVTLGNKTR 209

  Fly   387 MGVAL 391
            .|:.:
  Fly   210 RGMEI 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 25/124 (20%)
ppk26NP_648125.3 ASC 74..570 CDD:279230 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.