DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and ppk14

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_609017.2 Gene:ppk14 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster

Alignment Length:311 Identity:64/312 (21%)
Similarity:110/312 (35%) Gaps:96/312 (31%)


  Fly     9 LLLTINRFLGVYPSGRVGVLRWLHTLWSLFLLMYIWTGSIVKCLEFTVEIPTIEKLLYLMEFPGN 73
            |||.:....|.:..|..|    |...|...:...:|.|       |.:|:....:.        |
  Fly   241 LLLRLLLREGQHAPGNSG----LKGFWLTVVESSVWFG-------FPIEVVPHSRT--------N 286

  Fly    74 MATIAILVYY--AVLNRP-------LAHGAELQIERIITGLK-------GKAKRLVYKRHGQRTL 122
            :|..|:..|:  :.|:.|       :.:..|.:..|.:.|.|       .:.::....|:...|:
  Fly   287 VAVTAVYHYFDESTLSLPSSWRHCVMDYEEESEHFRTLEGQKYMLENCQAECQQRYLLRYCNCTV 351

  Fly   123 HLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQ-YAQP-----VH--FLW 179
            .|......:.. |.|.|                   ||.|.....:|| :.||     ||  ...
  Fly   352 DLFYPPSNYPA-CRLKD-------------------LPCLAAHNHLLQNFEQPGEHPYVHREESG 396

  Fly   180 LVMDQMRMCLKELKLL-------QRP--PQGSTKLDACYESAF----AVLVDAGGGSALMIEEMR 231
            ||.:.:..| |.|.||       |:|  ...|:.:::.:.:.:    ::||              
  Fly   397 LVCECLHNC-KSLTLLTDMRKSVQQPWLQPNSSAIESMWLNVYFKKPSMLV-------------- 446

  Fly   232 YTCNLIEQVHSQFLLRFGLYLVLNLLNSLVSICVELYLIFNFFETP--LWE 280
            |..||| ......::.||....|.|..|::|: :| ::.|..::.|  .||
  Fly   447 YKTNLI-YTWVDLIVSFGGICQLCLGCSIISL-IE-FVFFALYKVPQLYWE 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 64/312 (21%)
ppk14NP_609017.2 ASC 45..483 CDD:279230 60/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.