DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and Gr9a

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster

Alignment Length:358 Identity:82/359 (23%)
Similarity:149/359 (42%) Gaps:94/359 (26%)


  Fly    96 LQIERIITG---LKGKAKRLVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNSVY 157
            |.:|..:||   |.|    ||....|.|...|:::|.:   :.:|:::|. :.|.:.|..:....
  Fly     3 LWLEHFLTGYFQLCG----LVCGWSGSRLGRLLSSTFL---VLILIELVG-EIETYFTEENPDNE 59

  Fly   158 NLPGLM--MSLGVLQYAQPVHFLWLVMDQMRMCLKELKLLQR-PPQGSTK-----------LDAC 208
            ::|...  :.:||....:.:| .|:.:..:..|.:...||:. ||..:|.           |.||
  Fly    60 SVPAYFAKVIMGVNMAYKMIH-AWIALSALFECRRFRYLLEELPPVKATSFIYRHLILEIILFAC 123

  Fly   209 YESAFAVLVD---AGGGSALMIEEMRYTCNL--------------------IEQVHSQFL----- 245
              :||.||.:   .|    :.:|.:||..:|                    :||:|.:.:     
  Fly   124 --NAFLVLSEYTIRG----IYLENLRYAYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSD 182

  Fly   246 ---LR----------------FGL-YLVLNL--LNSLVSICVELYLIFNFFETP----LWEESVL 284
               ||                ||| .|:||:  |...:.:|...:::......|    |:.:.:.
  Fly   183 YKTLRLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMF 247

  Fly   285 LVYRLLWLAMHGGRIWFILSVNEQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQRSIDQPL 349
            :|...|.      :||.|.:.:.:.:.:..:|.|.|.:|...:...:..|..|.||:.:...| :
  Fly   248 VVCPTLI------KIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQ-I 305

  Fly   350 EACGIVTLDTRSLGG-FIGVLMAIVIFLIQIGL 381
            :.|||..|:.::|.| |..:|.|:||||..:.|
  Fly   306 DVCGIYHLNLQTLAGMFFFILEALVIFLQFVSL 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 81/357 (23%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 79/350 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.