DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and Asic4

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_898843.1 Gene:Asic4 MGIID:2652846 Length:539 Species:Mus musculus

Alignment Length:203 Identity:36/204 (18%)
Similarity:64/204 (31%) Gaps:75/204 (37%)


  Fly    67 LMEFPGNMATIAILVYYAVLNRPL--------------------AHGAELQIERIITGLKGKAKR 111
            ::..|||.......:|....:..|                    .:|.|:.:.:|..  :|.|:.
Mouse   335 MVHMPGNETICPPNIYIECADHTLDSLGGGSEGPCFCPTPCNLTRYGKEISMVKIPN--RGSARY 397

  Fly   112 LVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYDFEFWTT--WSSNSVYNLPGLMMSLG------- 167
            |. :::.:...::....||       :||.   ||..|:  ....:.|.|..|:..||       
Mouse   398 LA-RKYNRNETYIRENFLV-------LDVF---FEALTSEAMEQQAAYGLSALLGDLGGQMGLFI 451

  Fly   168 ---------VLQYAQPVHFLWLVMDQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAGGGS 223
                     :|.|...|.  |          ..||.:.|.|:...:            ...||.|
Mouse   452 GASILTLLEILDYIYEVS--W----------DRLKRVWRRPKTPLR------------TSTGGIS 492

  Fly   224 ALMIEEMR 231
            .|.::|::
Mouse   493 TLGLQELK 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 36/204 (18%)
Asic4NP_898843.1 ASC 40..488 CDD:295594 31/190 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.