DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and acd-5

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_491196.3 Gene:acd-5 WormBaseID:WBGene00020903 Length:714 Species:Caenorhabditis elegans

Alignment Length:49 Identity:12/50 (24%)
Similarity:22/50 (44%) Gaps:12/50 (24%)


  Fly    35 WSLFLLMYIWTGSIVKCL-------EFTVEIPTIEKLLYL-----MEFP 71
            ||....::||..|::..|       ...:..||:.::.:|     |:||
 Worm   132 WSCVFWVFIWISSMIMLLTQVTSLISMYISKPTVSQVSFLLSEGGMQFP 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 12/50 (24%)
acd-5NP_491196.3 ASC 114..547 CDD:279230 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.