| Sequence 1: | NP_788431.1 | Gene: | Gr59e / 37725 | FlyBaseID: | FBgn0041233 | Length: | 399 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_732664.2 | Gene: | Gr93b / 117472 | FlyBaseID: | FBgn0045470 | Length: | 395 | Species: | Drosophila melanogaster | 
| Alignment Length: | 363 | Identity: | 78/363 - (21%) | 
|---|---|---|---|
| Similarity: | 136/363 - (37%) | Gaps: | 93/363 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    65 LYLMEFPGNMATIAILVYYAVLNRPLAHGAE--------LQIERIITGLKGKAKRLVYKRHGQRT 121 
  Fly   122 LHLMATTLVFHGLCVLVD---------VVNYDFEFWTTWSSNSVYNLPGL-MMSLGVLQYAQPVH 176 
  Fly   177 FLWLVMDQMRMCLKEL----KLLQRPPQGS----TKLDACYESAFAVLVDAGGGSALMIEEMRYT 233 
  Fly   234 CNLIEQVHSQFLLRFGLYLVLNLLNSLVSICVELY--LIFNFFETPLWEESVLLVYRLLWL---- 292 
  Fly   293 --AMHGGRIWFILS------VNEQILEQKCNLCQLLNELEVCSSRLQ-RTINRFLLQLQRSIDQP 348 
  Fly   349 LEACGIVTLDTRSLGGFIGVLMAIVIFLIQIGLGNKSL 386 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Gr59e | NP_788431.1 | 7tm_7 | 9..381 | CDD:285581 | 77/356 (22%) | 
| Gr93b | NP_732664.2 | 7tm_7 | 24..391 | CDD:285581 | 78/357 (22%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21143 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||