DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and Gr93b

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster

Alignment Length:363 Identity:78/364 (21%)
Similarity:136/364 (37%) Gaps:93/364 (26%)


  Fly    65 LYLMEFPGNMATIAILVYYAVLNRPLAHGAE--------LQIERIITGLKGKAKRLVYKRHGQRT 121
            :||..|.|......::....:|......|.|        ||:.|.:..|....|    .|.|.|.
  Fly    85 MYLRAFFGFRLIGCLICSVIILVMQFWFGEELINLVNRFLQLFRRMQSLTNSPK----NRFGDRA 145

  Fly   122 LHLMATTLVFHGLCVLVD---------VVNYDFEFWTTWSSNSVYNLPGL-MMSLGVLQYAQPVH 176
            ..|:..:.||..|.|.:.         ::....:.:|:..:..:.:|..: .:|:||| |....:
  Fly   146 EFLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDLYTSVGTGMITHLCFVGYLSIGVL-YRDLNN 209

  Fly   177 FLWLVMDQMRMCLKEL----KLLQRPPQGS----TKLDACYESAFAVLVDAGGGSALMIEEMRYT 233
            :   |..|:|..|:.|    ...:..||.:    :.||.|.                      |.
  Fly   210 Y---VDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCL----------------------YL 249

  Fly   234 CNLIEQVHSQFLLRFGLYLVLNLLNSLVSICVELY--LIFNFFETPLWEESVLLVYRLLWL---- 292
            .:.|.||...|...|.|.|.|:|..||:::.:..|  ::...:...||...:.|:..::.|    
  Fly   250 YDEIHQVSRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWGLVIKLLIDVVLLTMSV 314

  Fly   293 --AMHGGRIWFILS------VNEQILEQKCNLCQLLNELEVCSSRLQ-RTINRFLLQLQRSIDQP 348
              |::|.|:...||      .:.|...||         ||:...||| :.:..|.|.|       
  Fly   315 HSAVNGSRLIRRLSFENFYVTDSQSYHQK---------LELFLGRLQHQELRVFPLGL------- 363

  Fly   349 LEACGIVTLDTRSLGGFIGVLMAIVIFLIQIGLGNKSL 386
            .|....:||      .|:..::..::||:|.|:.::.:
  Fly   364 FEVSNELTL------FFLSAMVTYLVFLVQYGMQSQQI 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 78/357 (22%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 78/358 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.