DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr59e and asic4

Sequence 1:NP_788431.1 Gene:Gr59e FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_017952921.1 Gene:asic4 XenbaseID:XB-GENE-940165 Length:318 Species:Xenopus tropicalis

Alignment Length:121 Identity:26/122 (21%)
Similarity:46/122 (38%) Gaps:32/122 (26%)


  Fly    67 LMEFPGNMATIAILVYYAVLNRPL--------------------AHGAELQIERIITGLKGKAKR 111
            ::..||| .||...|.|...:..|                    .:..|:.:.||..  ||.|:.
 Frog   115 MVHMPGN-ETICSPVMYMCADHILDNMVEDTSEKCSCPTPCNLTRYSKEISMVRIPN--KGSARY 176

  Fly   112 LVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLG 167
            |. :::.:...::....||   |.:..:.:||:     |......|:||.|:..:|
 Frog   177 LA-RKYNKNETYIRENFLV---LDIFFEALNYE-----TIEQKKAYDLPSLLGDIG 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 26/122 (21%)
asic4XP_017952921.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.