DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG34260

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster

Alignment Length:136 Identity:24/137 (18%)
Similarity:54/137 (39%) Gaps:25/137 (18%)


  Fly    11 LGCVVVTVVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTKVI--MDMILVTTLRQGLKAHLSF 73
            |||.::.        :....:.:|...|...:..:::....:.|  .|::....|.:..|:.::.
  Fly    30 LGCQIIA--------KAYVNSLECLLVRQRTAVVAVKFSLNQTIEHFDVLATFDLIKKDKSRMNI 86

  Fly    74 -EFRLTKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIREG-YYYLHGWTL 136
             :.::...|...|:||:             :|..:.|..:..|.|...|||:.:| .|.:..:|.
  Fly    87 ADIKIDGCKYLGSMYQN-------------NIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTF 138

  Fly   137 DANNVP 142
            .::..|
  Fly   139 ISDEFP 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 14/63 (22%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.