DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33771

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster

Alignment Length:169 Identity:55/170 (32%)
Similarity:93/170 (55%) Gaps:3/170 (2%)


  Fly    14 VVVTVVIKQS---GPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEF 75
            ::|.:|.|..   |....|..|:.:||...|.||:|.|....:.|||.|...:::|.|||:....
  Fly     9 LLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAHVDILL 73

  Fly    76 RLTKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLDANN 140
            ||..||.:||::....:.||:....:.|:::.||..|.|..||..:||:..|:||:|.|.:.::.
  Fly    74 RLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYMHDWRMGSSM 138

  Fly   141 VPSFLYLGDYRISGSFYYGRFKKHLYNPLLECSVEAVLN 179
            ...||..|:||...:|:||::...|:...|..:::|:|:
  Fly   139 THKFLIPGEYRGKLTFFYGKYGTKLFEEALSLTIDAILS 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 28/91 (31%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062450
eggNOG 1 0.900 E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.