DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33758

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster

Alignment Length:185 Identity:35/186 (19%)
Similarity:63/186 (34%) Gaps:54/186 (29%)


  Fly    18 VVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGL-----------KAHL 71
            :|:..:.....|::..|......|..|.:..:|.        ::.||..:           |..:
  Fly    10 LVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKA--------ISRLRNSISVQYKLKQPVSKIFI 66

  Fly    72 SFEF--RLTKAKPYQSVYQHDMNYCALIKGSQESI------YRRWFTSMLKVGNFATSCP---IR 125
            ..||  |....:|:  :|....|.|..:..:...|      |.|.:.    |.|:  |||   |.
  Fly    67 RLEFFKRANGWRPF--LYNFTANLCDFLARNNNVIMGIGYAYLRPYL----VKNY--SCPFKVIE 123

  Fly   126 EGYYYLHGWTLDANNVPSF--LYLGDY--------------RISGSFYYGRFKKH 164
            ........:.||.||:.:.  :..|:|              .|:||..|..::::
  Fly   124 NELLECKDFELDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSIEYNNYREY 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 23/109 (21%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.