DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33648

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster

Alignment Length:104 Identity:20/105 (19%)
Similarity:35/105 (33%) Gaps:39/105 (37%)


  Fly    81 KPYQSVYQHDMNYCALIKGSQESIYRRW-----------------FTSMLKVGNFATS------- 121
            ||:  :|...::.|..::..:.:|..::                 |.|.:.|....|:       
  Fly    83 KPF--LYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLT 145

  Fly   122 --CPIREG-YYYLHGWTLDANNVPSFLYLGDYRISGSFY 157
              .|:.|| |.:...|         |.| ..||.|.:.|
  Fly   146 QVLPVPEGDYLFAFRW---------FSY-NIYRSSVNVY 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 19/104 (18%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 13/76 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50436
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.