DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33641

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster

Alignment Length:141 Identity:30/142 (21%)
Similarity:56/142 (39%) Gaps:14/142 (10%)


  Fly    20 IKQSGPRMTFRAGDCT-YNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFRLTKAKPY 83
            ||...|.: |...||. |..:..|..::::...|.:.|          |......||....|:..
  Fly    33 IKYKVPDI-FEKMDCNLYQANNRSYVNVEMKLKKEVSD----------LNVRAIMEFWKPNAQNK 86

  Fly    84 QSVYQHDMNYCALIKG-SQESIYRRWFTSMLKVGNFATSCPIREGY-YYLHGWTLDANNVPSFLY 146
            ..:|...::.|.:::. .:..::..:..|..|..|...|||.:..: |.:..|.||...:|.|..
  Fly    87 MKLYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAP 151

  Fly   147 LGDYRISGSFY 157
            :|.:|....::
  Fly   152 VGQFRTVTEYF 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 16/79 (20%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.