DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33702

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster

Alignment Length:177 Identity:40/178 (22%)
Similarity:77/178 (43%) Gaps:34/178 (19%)


  Fly    14 VVVTVVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTK--VIMDMILVTTLRQ--GLKAHLS-- 72
            |.:|:::..|.....||          |:||....:..:  |:.:.||....|.  |:..|::  
  Fly     9 VFLTIILFSSTLGAHFR----------FTNFKCISLDPEFAVVKECILKMVRRSVVGINFHIAIK 63

  Fly    73 -------FEFRLT---KAKPYQ-SVYQHDMNYCALI-KGSQESIYRRWFTSMLKVGNFATSCPIR 125
                   .||.|:   |:..|: .:..|.:::|..: :..|..|:..:..|::...|...|||..
  Fly    64 YSQPINKIEFNLSIFRKSNMYRLFLVNHTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYT 128

  Fly   126 EGYYYLHGWTLD---ANNVPSFLYLGDYRI---SGSFYYGRFKKHLY 166
            |...|:...|.:   ..::.|||.:|:|::   .|:|...|.:.:|:
  Fly   129 EKDIYVKKMTFNDKTLKDLLSFLPVGEYKLVVSVGAFGVWRLQVNLF 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 22/94 (23%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50307
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.