DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33483

DIOPT Version :9

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:181 Identity:46/181 - (25%)
Similarity:64/181 - (35%) Gaps:38/181 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VPFVLGCVVVTVVIKQSGPRMTFRAGDCTYNRSTFSNF----------SIQIIKTKVIMDMILVT 61
            |.:.|..:|:...:..|.....|....||.....|.:|          :.:.|..||.|..|.||
  Fly     3 VKYKLLIIVIFHSVNMSTSDFEFTNIKCTSLDKDFDDFEYCHLKSVNRTFKYISVKVRMYKIPVT 67

  Fly    62 TLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIRE 126
            .    :|.....||...|...:...:. |..||.|     :|:.|.:....|||.  ....||.:
  Fly    68 K----VKIASLVEFTNIKCTSWDKAFD-DFEYCHL-----KSVNRSFKYLSLKVN--LHKVPITK 120

  Fly   127 ------------GYY-YLHGWTLDANNVPSFLYLGDYRISGSFYYGRFKKH 164
                        ||. :|:..|:||...   |....|....||:||.||.|
  Fly   121 VKVNFSLLKRFNGYKPFLYNITVDACKA---LRHSKYNPIFSFFYGLFKHH 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 26/96 (27%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.