DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG30050

DIOPT Version :8

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster

Alignment Length:164 Identity:28/165 (17%)
Similarity:63/165 (38%) Gaps:14/165 (8%)


  Fly     6 LVPFV--LGCVVVTV-------VIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVT 61
            ::|.:  .|.:|.::       :|...|..:..:..||..|.:.|:|...:||..|.......|.
  Fly     1 MLPIIWWFGIIVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPNYFANLYCRIIPPKNRTMEASVN 65

  Fly    62 TLRQGLKAHLSFEFRLTKAKP-YQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATS--CP 123
            .::|......|....:..||. ...::....:.|.:::..:..|......:.|...:.|.:  ||
  Fly    66 IMQQLSVFSGSLRVSIPNAKKVITQIFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCP 130

  Fly   124 IREGYYYLHGWTLDANNVPSFLYLGDYRISGSFY 157
            ..:|.:  ....:...::|..|...::.::..|:
  Fly   131 FPKGKF--ESRNISVTDLPPMLTESEFFVNLDFF 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 10/80 (13%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 10/76 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.