powered by:
Protein Alignment CG33914 and AgaP_AGAP011021
DIOPT Version :9
| Sequence 1: | NP_001027394.2 |
Gene: | CG33914 / 3772464 |
FlyBaseID: | FBgn0053914 |
Length: | 189 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_001688209.1 |
Gene: | AgaP_AGAP011021 / 5667968 |
VectorBaseID: | AGAP011021 |
Length: | 164 |
Species: | Anopheles gambiae |
| Alignment Length: | 114 |
Identity: | 22/114 - (19%) |
| Similarity: | 46/114 - (40%) |
Gaps: | 40/114 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 FTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYFQLMTRGSESIHAASNW 92
|.::|.:.|||.:..: |.:|| ::.|:::|::|
Mosquito 37 FLDITRKVKDLRLLFI-YNSVT------SNGSIQHAIIK-------------------------- 68
Fly 93 QPFLHTMKLDLCRFWKN-HHNHLARMVFEFIDGHTNMNHTCPYTKEKYI 140
..:|:|.|.:| ..:.|.:..::::..|||:...||.....|:
Mosquito 69 ------RSIDMCSFMRNPRTDRLLKSFYDYVRVHTNIPLKCPLPPGSYM 111
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33914 | NP_001027394.2 |
DUF1091 |
85..166 |
CDD:284008 |
11/57 (19%) |
| AgaP_AGAP011021 | XP_001688209.1 |
DUF1091 |
66..133 |
CDD:284008 |
12/78 (15%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR20898 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.