DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33914 and AgaP_AGAP010995

DIOPT Version :9

Sequence 1:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_001688235.1 Gene:AgaP_AGAP010995 / 5667831 VectorBaseID:AGAP010995 Length:192 Species:Anopheles gambiae


Alignment Length:157 Identity:40/157 - (25%)
Similarity:63/157 - (40%) Gaps:35/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLLFLTELHGVF-MR-------FTNVTCES--KDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPM 68
            |||.:|.||.|. :|       ..||..:|  |.|:.|.|.:   .|.|::|..:.|.   :|.:
Mosquito    13 CLLLITILHPVAGLRSLKTIPIVKNVITQSNPKYLNASTVPH---NTPSESKVDLILD---VKRL 71

  Fly    69 FTNIEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNH-LARMVFEFIDGHTNMNHTC 132
            .:|:.:.|.|...     ..:...|..|:...:|.|.|.||...| |.:::...:..:.||...|
Mosquito    72 MSNLHMNFVLWVN-----VISGTLQVPLYNQTIDFCEFLKNPSVHPLGQIIHREVKRNGNMPSKC 131

  Fly   133 PYTKEKYISIDDLTNTEVSAKIRGVPM 159
            |...:.|             ...|:||
Mosquito   132 PIAADLY-------------AFYGIPM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 17/76 (22%)
AgaP_AGAP010995XP_001688235.1 DUF1091 77..161 CDD:284008 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.